PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538687.1_FGP067
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 320aa    MW: 34326 Da    PI: 5.0978
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538687.1_FGP067genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS39.11.1e-123588255
               GRAS  2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55
                       ++lLl+cA a++s+d +laq++++ l+++as++gdp qRl++ +++AL ar  r
  KN538687.1_FGP067 35 QQLLLHCAAALESNDVTLAQQAMWVLNNIASSQGDPSQRLTSWLLRALVARACR 88
                       699***********************************************9877 PP

2GRAS124.11.7e-3897318159374
               GRAS 159 eetgerLakfAeelgvpfefnvl..............vakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvksl 234
                        +e+g rLa fA++ gv++efnv+              ++++l+++  ++ +L ++ gEa++Vn++  l ++       +++rd +L++v+ l
  KN538687.1_FGP067  97 SELGARLAIFAKSKGVQLEFNVVesatttspkkttttLCQELASVlsDPPSLGLRDGEAVVVNCQSWLRHVA------PDTRDLFLDTVRAL 182
                        689********************998888766654443334433367888899999************9998......66789********* PP

               GRAS 235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                        +P +v+v++++ad++s+s++ r++ ++++++ l+d+l+ ++p++s  r   E++ +gr+i++v+  e  +  er e  ++  er+++ GF  
  KN538687.1_FGP067 183 NPCLVTVTDEDADLGSPSLASRLAGCFDFHWILLDALDISAPKDSPRRLEQEAA-VGRKIESVIGEEDGA--ERSEPGARLAERMSRKGFAG 271
                        ************************************************999999.**********99988..9******************* PP

               GRAS 327 vplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        v ++e+aa+++++ll++++  g+ v+ e++ lvl+Wk+++ v++ aW+
  KN538687.1_FGP067 272 VVFDEEAAAEVRRLLSEHA-TGWGVKREDDMLVLTWKGHAAVFTGAWT 318
                        *******************.99*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098516.9311299IPR005202Transcription factor GRAS
PfamPF035143.9E-103588IPR005202Transcription factor GRAS
PfamPF035145.8E-3697318IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MDMERELRGG GVGAAAHGSI CFSGGPVLVD GRRIQQLLLH CAAALESNDV TLAQQAMWVL  60
NNIASSQGDP SQRLTSWLLR ALVARACRLC AAAPVGSELG ARLAIFAKSK GVQLEFNVVE  120
SATTTSPKKT TTTLCQELAS VLSDPPSLGL RDGEAVVVNC QSWLRHVAPD TRDLFLDTVR  180
ALNPCLVTVT DEDADLGSPS LASRLAGCFD FHWILLDALD ISAPKDSPRR LEQEAAVGRK  240
IESVIGEEDG AERSEPGARL AERMSRKGFA GVVFDEEAAA EVRRLLSEHA TGWGVKREDD  300
MLVLTWKGHA AVFTGAWTPN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1133320.0AC113332.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1057_B02, complete sequence.
GenBankAC1305970.0AC130597.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0017K09, complete sequence.
GenBankAK0704890.0AK070489.1 Oryza sativa Japonica Group cDNA clone:J023050L12, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638716.11e-147PREDICTED: scarecrow-like protein 32
TrEMBLA0A0D3G9G61e-171A0A0D3G9G6_9ORYZ; Uncharacterized protein
STRINGORGLA05G0190100.11e-147(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122273238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-43GRAS family protein